RetrogeneDB ID: | retro_itri_786 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393322.1:7340071..7340304(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSTOG00000020092 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 61.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | LQYNDPNRRG-LIEDPALIRWTYARSANIYPNFRPTPKNSLLGALFGIGPL-FFWYYV-FKTDR-DRKEK |
| .Q..D.N..G...EDPALI.WTY.RSANIY.NFRPTPKN.LLGAL.GIGPL.FFWYYV.FKT.R.DRKEK | |
| Retrocopy | IQNHDHNQEG<VMEDPALIHWTYSRSANIYLNFRPTPKNLLLGALIGIGPL<FFWYYV<FKTNR<DRKEK |
| Parental | LIQEGKLDRKFNI |
| L..EGK....FNI | |
| Retrocopy | LTWEGKFH*TFNI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |