RetrogeneDB ID: | retro_itri_966 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393352.1:2092116..2092307(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBL5 | ||
| Ensembl ID: | ENSSTOG00000005286 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
| Percent Identity: | 84.62 % |
| Parental protein coverage: | 87.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKD-HVSLGDYEIHDGMNLELYYQ |
| LGK.V.VKCNTDDTI..LKKL..AQTGT.WNKIVLKK.YTIFKD.HV.LGDYEIHDGMNLELYYQ | |
| Retrocopy | LGKNVCVKCNTDDTIVGLKKLVEAQTGTGWNKIVLKKGYTIFKD<HVFLGDYEIHDGMNLELYYQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012371 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000032630 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
| Dipodomys ordii | ENSDORG00000006499 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029004 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000013412 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020442 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005286 | 1 retrocopy |
retro_itri_966 ,
|