RetrogeneDB ID: | retro_dnov_1858 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_33694:513..729(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBL5 | ||
Ensembl ID: | ENSDNOG00000006384 | ||
Aliases: | None | ||
Description: | ubiquitin-like 5 [Source:HGNC Symbol;Acc:13736] |
Percent Identity: | 79.45 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVCLGDYEIHDGMNLEL |
.IEVV.N..LGKKV..K.NTD..IGDLKKLIAAQTGT.WNKIVL.KWY.IFKDHV.LGDYEIHDGMN.E. | |
Retrocopy | IIEVVSNNHLGKKVHMKYNTDESIGDLKKLIAAQTGTHWNKIVL-KWYMIFKDHVYLGDYEIHDGMNVEI |
Parental | YYQ |
YYQ | |
Retrocopy | YYQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 202 .05 RPM |
SRP012922_cerebellum | 0 .00 RPM | 161 .80 RPM |
SRP012922_heart | 0 .00 RPM | 239 .46 RPM |
SRP012922_kidney | 0 .27 RPM | 312 .67 RPM |
SRP012922_liver | 0 .00 RPM | 86 .07 RPM |
SRP012922_lung | 0 .15 RPM | 220 .84 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 124 .97 RPM |
SRP012922_spleen | 0 .00 RPM | 213 .93 RPM |