RetrogeneDB ID: | retro_mdom_588 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:422741504..422741903(-) | ||
| Located in intron of: | ENSMODG00000019794 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000008032 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.09 % |
| Parental protein coverage: | 53.78 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 2 |
| Parental | CCTASTSIAAHEDASHSYGFNFNHCGTMTPACKRHFVQDTCLYECSPNLGPWIQPVNSSWRKERVMNIPL |
| CCT...S.AAHED.SH.Y.F..NH.G.M.P.CK.HF.QDT..YE.S.NLGP..Q.......KE.....P. | |
| Retrocopy | CCTVNISLAAHEDTSHLYNFKYNHFGMMSPTCKHHFIQDTRVYE*SSNLGPSFQQKDLCRWKE*MLIMPS |
| Parental | CKEDCNMWWEDCKTSYTCKENWQKGWNWSSG-INECPVKAACHPFSFYFPTPTSLC-ENIWSRSYNA |
| C.E..N.W.ED....YT..E..Q......SG.IN..P.KA..HPF.FY.PTP.SL..ENIW..SY.A | |
| Retrocopy | CRENYNHW*EDYR-YYTSRELAQR-LEFDSG>IN*YPCKAV*HPFTFYSPTPASLV<ENIWNHSYKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .20 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005777 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000015224 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000000856 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000015365 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014126 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000008017 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000008032 | 1 retrocopy |
retro_mdom_588 ,
|
| Monodelphis domestica | ENSMODG00000008042 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000001827 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000165 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000641 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000003503 | 3 retrocopies |