RetrogeneDB ID: | retro_mdom_719 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:219182258..219182579(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL20 | ||
| Ensembl ID: | ENSMODG00000006562 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L20 [Source:HGNC Symbol;Acc:14478] |
| Percent Identity: | 57.27 % |
| Parental protein coverage: | 73.83 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | FRGRKNRCHRLAVRTETSAFVKCSKARRLKKKNMRTLWINRITAASQEHGLKYPSFISNLVKCQVELNRK |
| F.GRKN.C..LA.........KC..ARR.KK.NM.TLWIN.I..AS.EH.LKYPSFISNL..C.VEL.RK | |
| Retrocopy | FGGRKNWCFKLAIGDVNGVLAKCVYARRIKK-NMKTLWINGIKPAS*EHSLKYPSFISNL--CHVELSRK |
| Parental | VLADLAIYEPKTFKSLAALAKRRREEGFAAALGDEKEPAG |
| VLA.L..YE.KT..SLA.L.KRR.EE..A.......E..G | |
| Retrocopy | VLAYLVTYEFKTLTSLATLTKRRKEESLATDIFEI*ERVG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013932 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000019259 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010105 | 1 retrocopy | |
| Homo sapiens | ENSG00000242485 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027251 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011857 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000006562 | 2 retrocopies |
retro_mdom_1424, retro_mdom_719 ,
|
| Mus musculus | ENSMUSG00000029066 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005968 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000001425 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008735 | 2 retrocopies |