RetrogeneDB ID: | retro_meug_149 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | GeneScaffold_4335:2714..2951(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMEUG00000015637 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 74.68 % |
Parental protein coverage: | 78.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MASATGFIQWLRNSASGHNLQAKLQLRYQEIAKRTQPPPKLPVGPSHKFSNNYYCTRDGRRQASPPSIVM |
MASATGFIQ.LRNSAS..NLQAKLQL..Q..AKRTQPP.KLPVGPSHKFSNNYYCT.D.R.Q.SPP.I.M | |
Retrocopy | MASATGFIQGLRNSASRYNLQAKLQLCHQDTAKRTQPPSKLPVGPSHKFSNNYYCTHDVRQQSSPPLIIM |
Parental | SEEAITTSG |
....I..SG | |
Retrocopy | TTVKILESG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000685 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010709 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000012324 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000015637 | 3 retrocopies |
retro_meug_1487, retro_meug_149 , retro_meug_587,
|
Rattus norvegicus | ENSRNOG00000006939 | 2 retrocopies |