RetrogeneDB ID: | retro_mmul_1089 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 14:113613..114032(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS24 | ||
Ensembl ID: | ENSMMUG00000002405 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.02 % |
Parental protein coverage: | 85.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | PCAWRALHTSAVCAKNR-AARVRVGK-GDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVED |
PCA.RALHTSAV...NR.AARVR.G..GDKP.T.E.AHAPH..A........H......E..AAERTVE. | |
Retrocopy | PCAGRALHTSAVRDENR<AARVRGGR<GDKPAT*EDAHAPHFVARLRAGGRSH-AEPGREGRAAERTVEG |
Parental | VFLRKFMWGTFPGCLADQLVLKRRGNQLEICALVLRNLPPHKYYFLVGYSETLLSYFYK-CPV-RLHLQT |
V.......G..PG..ADQ.V...R....E.CA.VLR.LP.....FLVG..ET.LS.....CP...LH.QT | |
Retrocopy | VSVAHSCRG-LPGRPADQRVVPLRASRWESCAPVLRHLPARTFCFLVGHRETSLSHLPR<CPL<ALHVQT |
Parental | VPSKVVY |
.PS..VY | |
Retrocopy | APSEAVY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 1 .23 RPM | 13 .78 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 34 .67 RPM |
SRP007412_cerebellum | 0 .65 RPM | 12 .27 RPM |
SRP007412_heart | 1 .53 RPM | 28 .85 RPM |
SRP007412_kidney | 0 .82 RPM | 30 .40 RPM |
SRP007412_liver | 1 .62 RPM | 29 .93 RPM |
SRP007412_testis | 0 .75 RPM | 16 .32 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017491 | 1 retrocopy | |
Bos taurus | ENSBTAG00000007398 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003106 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000016853 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000016782 | 1 retrocopy | |
Homo sapiens | ENSG00000062582 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005692 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000011905 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000002405 | 1 retrocopy |
retro_mmul_1089 ,
|
Monodelphis domestica | ENSMODG00000013889 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000019127 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000015911 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000002938 | 1 retrocopy |