RetrogeneDB ID: | retro_mmul_1894 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:81495006..81495420(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.3989 | ||
Ensembl ID: | ENSMMUG00000000811 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.09 % |
Parental protein coverage: | 63.01 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVILAFLLFVYEQKLNEYVAKGLTDSIHRYH |
.IVGSII.VVAFLGC.GS.K.N.CLL.S.FILLLIILLA.V.LA.L.FVYEQKLN..VA.GL.DSI..YH | |
Retrocopy | LIVGSIITVVAFLGCVGSVKKNRCLLTSLFILLLIILLAKVTLAILHFVYEQKLNV*VAEGLMDSICHYH |
Parental | SDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSNFLYIGIITICVCV |
.DNSTKA.WDSIQSFL.CCG.N..SDW.SG..ASCPSDP.V.GCYAKARL.FH.NFLYI.IITICV.V | |
Retrocopy | RDNSTKAMWDSIQSFLHCCGLNSKSDWSSGQQASCPSDPKVKGCYAKARL*FHDNFLYIRIITICVYV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .34 RPM | 20 .62 RPM |
SRP007412_brain_prefrontal_cortex | 0 .16 RPM | 29 .43 RPM |
SRP007412_cerebellum | 0 .13 RPM | 2 .39 RPM |
SRP007412_heart | 0 .06 RPM | 4 .59 RPM |
SRP007412_kidney | 0 .47 RPM | 5 .16 RPM |
SRP007412_liver | 0 .24 RPM | 18 .56 RPM |
SRP007412_testis | 0 .00 RPM | 1 .28 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000010760 | 2 retrocopies | |
Homo sapiens | ENSG00000143119 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000005468 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000811 | 1 retrocopy |
retro_mmul_1894 ,
|
Nomascus leucogenys | ENSNLEG00000003649 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016713 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000001085 | 1 retrocopy |