RetrogeneDB ID: | retro_mmul_2109 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 6:123054360..123054550(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSMMUG00000015207 | ||
| Aliases: | None | ||
| Description: | bolA-like protein 3 [Source:RefSeq peptide;Acc:NP_001252580] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 59.81 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KFPRATAIKVTDISG-GCGAMYEIKIESEEF-KEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPK |
| KFP.ATA.KVTDISG..CG.M.EIKIESEE..KEKRT.QQHQMVNQALKEEIK.MH.LRIFTSVPK | |
| Retrocopy | KFP*ATAVKVTDISG<SCGTMDEIKIESEEL<KEKRTAQQHQMVNQALKEEIKRMHELRIFTSVPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 10 .31 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .82 RPM |
| SRP007412_heart | 0 .00 RPM | 20 .43 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .85 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .54 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .33 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3383 |
| Pan troglodytes | retro_ptro_2299 |
| Gorilla gorilla | retro_ggor_2290 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Homo sapiens | ENSG00000163170 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024505 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000015207 | 2 retrocopies |
retro_mmul_1181, retro_mmul_2109 ,
|
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000320 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012285 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012078 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy |