RetrogeneDB ID: | retro_sara_83 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | GeneScaffold_2346:17717..17907(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BOLA3 | ||
| Ensembl ID: | ENSSARG00000001754 | ||
| Aliases: | None | ||
| Description: | bolA homolog 3 (E. coli) [Source:HGNC Symbol;Acc:24415] |
| Percent Identity: | 96.88 % |
| Parental protein coverage: | 57.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PRATAIKVTDISGGCGAMYEIQIESEDFKAKKIVQQHQMVNQALKEEIKGMHGLR-IFTSVPKR |
| PRA.AIKVTDISGGCGAMYEIQIESEDFKAKKIVQQHQMVNQALKEEIKGMHGLR.IFTSVPKR | |
| Retrocopy | PRAIAIKVTDISGGCGAMYEIQIESEDFKAKKIVQQHQMVNQALKEEIKGMHGLR>IFTSVPKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies | |
| Homo sapiens | ENSG00000163170 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024505 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015207 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000320 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012285 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012078 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy |
retro_sara_83 ,
|
| Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |