RetrogeneDB ID: | retro_mmus_1648 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 17:56014279..56014555(-) | ||
| Located in intron of: | ENSMUSG00000003199 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000084755 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Bola3 | ||
| Ensembl ID: | ENSMUSG00000045160 | ||
| Aliases: | None | ||
| Description: | bolA-like 3 (E. coli) [Source:MGI Symbol;Acc:MGI:1925903] |
| Percent Identity: | 91.4 % |
| Parental protein coverage: | 97.89 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GLPLWHCAQRMFASQTEGELKVTQVLKEKFPRATAIQVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMV |
| G...WHCAQRMFASQ.EGELKVTQVLKEKFPRATA.QVTDISGGCGAMYEI.IES.EFKEKRTVQQHQMV | |
| Retrocopy | GARRWHCAQRMFASQMEGELKVTQVLKEKFPRATALQVTDISGGCGAMYEIRIES-EFKEKRTVQQHQMV |
| Parental | NQALKEEIKGMHGLRIFTSVPKC |
| NQ.LKEEIKGMHGLRIFTSVPKC | |
| Retrocopy | NQVLKEEIKGMHGLRIFTSVPKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .30 RPM | 10 .37 RPM |
| SRP007412_cerebellum | 0 .48 RPM | 22 .06 RPM |
| SRP007412_heart | 0 .09 RPM | 78 .04 RPM |
| SRP007412_kidney | 0 .10 RPM | 54 .05 RPM |
| SRP007412_liver | 0 .38 RPM | 33 .32 RPM |
| SRP007412_testis | 0 .05 RPM | 34 .30 RPM |
| ENCODE library ID | Target | ChIP-Seq Peak coordinates |
|---|---|---|
| ENCFF001YIJ | POLR2A | 17:56015351..56015429 |
| ENCFF001YKA | POLR2A | 17:56015504..56015766 |
| ENCFF001YKA | POLR2A | 17:56015059..56015083 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008739 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000017844 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008309 | 2 retrocopies | |
| Homo sapiens | ENSG00000163170 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024505 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016364 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015207 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007813 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045160 | 1 retrocopy |
retro_mmus_1648 ,
|
| Nomascus leucogenys | ENSNLEG00000000320 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016658 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003502 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012285 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000012078 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000001754 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008291 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006698 | 3 retrocopies |