RetrogeneDB ID: | retro_mmul_2514 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | X:83765322..83765547(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D4 | ||
Ensembl ID: | ENSMMUG00000002410 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 4 (putative) [Source:HGNC Symbol;Acc:21647] |
Percent Identity: | 57.33 % |
Parental protein coverage: | 51.02 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT |
M.LK.I.KE...L..D....CSAGPV.DD..HWQAT...P.D..Y.GG.FFL.I.FP.D..FKPPK..FT | |
Retrocopy | MTLKLIHKEFLHLAGDS*PHCSAGPVWDDMLHWQATETRPKDPSYLGGIFFLRIQFPSDCLFKPPKIKFT |
Parental | TKIYH |
..IYH | |
Retrocopy | NGIYH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 27 .45 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .14 RPM |
SRP007412_cerebellum | 0 .00 RPM | 21 .25 RPM |
SRP007412_heart | 0 .06 RPM | 24 .91 RPM |
SRP007412_kidney | 0 .23 RPM | 28 .05 RPM |
SRP007412_liver | 0 .00 RPM | 27 .35 RPM |
SRP007412_testis | 3 .47 RPM | 68 .79 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4723 |
Pongo abelii | retro_pabe_30 |
Rattus norvegicus | retro_rnor_345 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003997 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000007875 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000006888 | 5 retrocopies | |
Homo sapiens | ENSG00000078967 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000003378 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000011919 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000002410 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000008069 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000020666 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003364 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008900 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000029727 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000016722 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000003691 | 9 retrocopies | |
Tarsius syrichta | ENSTSYG00000000595 | 14 retrocopies |