RetrogeneDB ID: | retro_mmul_519 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1:109418769..109419148(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | OOEP | ||
Ensembl ID: | ENSMMUG00000000416 | ||
Aliases: | None | ||
Description: | oocyte expressed protein [Source:HGNC Symbol;Acc:21382] |
Percent Identity: | 54.96 % |
Parental protein coverage: | 94.07 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 4 |
Parental | SQRGKQTPADSLEQLRMLPLP-PPQIRIRP-WWFPVQELGDPLVFYLEAWLADELFGPDRAMIPE-MEWT |
...GK.T.....E.L..LPLP.PPQI.....WWF.VQ.L.DP..FYLE..LAD..F..DRA......EW. | |
Retrocopy | TESGKWTLSHYMEKLLRLPLP<PPQILMGS<WWFLVQ*LRDPSMFYLEV*LADAIFEVDRAIFQD<LEWM |
Parental | SQALMTVDIVDSGNLV-EITVFGRPSVQNRVKSMLLCLASFHREHRARAEKMKHLEKNLKA |
SQ.L..VDIVDSG..V..ITVFG...V.NRVK.M.LCL...H..H.A.AEK.KH.E.NLKA | |
Retrocopy | SQSLLMVDIVDSGIQV>KITVFGQLCV*NRVKTMFLCLTWLHQQHHA*AEKIKHPEENLKA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .04 RPM | 1 .73 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_432 |
Pan troglodytes | retro_ptro_329 |
Gorilla gorilla | retro_ggor_422 |
Callithrix jacchus | retro_cjac_3033 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009962 | 1 retrocopy | |
Homo sapiens | ENSG00000203907 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000016832 | 3 retrocopies | |
Loxodonta africana | ENSLAFG00000012754 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000017174 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000000416 | 2 retrocopies |
retro_mmul_2561, retro_mmul_519 ,
|
Nomascus leucogenys | ENSNLEG00000001204 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000025904 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029545 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000025957 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001487 | 2 retrocopies |