RetrogeneDB ID: | retro_mputfur_217 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
Coordinates: | GL896898.1:31694348..31694555(-) | ||
Located in intron of: | ENSMPUG00000014365 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C19orf70 | ||
Ensembl ID: | ENSMPUG00000006136 | ||
Aliases: | None | ||
Description: | chromosome 19 open reading frame 70 [Source:HGNC Symbol;Acc:33702] |
Percent Identity: | 65.22 % |
Parental protein coverage: | 58.47 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | PPAMYQFSQYVCEQTGLKMPQLPAPPKFNFHIRDTWNSGIITVMSALSVAPSKACEYSKEGWEYLKERT |
PPAM..FSQY.CEQT.LK.P.LP..PKF..HI...WNSGII..M..LS.APSK..EYSKE.W.YLK..T | |
Retrocopy | PPAMDHFSQYLCEQTSLKIPWLPVSPKFISHIHKSWNSGIIMLMFFLSLAPSKTQEYSKESWGYLKGQT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000018796 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000017076 | 2 retrocopies | |
Felis catus | ENSFCAG00000011836 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000026050 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000028920 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001268 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006136 | 2 retrocopies |
retro_mputfur_1001, retro_mputfur_217 ,
|
Procavia capensis | ENSPCAG00000006583 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013386 | 1 retrocopy |