RetrogeneDB ID: | retro_ocun_1527 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 9:112705375..112705720(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM206A | ||
Ensembl ID: | ENSOCUG00000001882 | ||
Aliases: | None | ||
Description: | family with sequence similarity 206, member A [Source:HGNC Symbol;Acc:1364] |
Percent Identity: | 75.83 % |
Parental protein coverage: | 59.69 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | SISYQISTNCSRLQNKVSGKFKR-GAQFLTEFAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHEPSIL |
SISYQI..NCSRLQN.VSG.FKR.GAQFLTEFAP..KI.CS.G.E.T.SSCVRGRLMEV.E.ILHEPS.L | |
Retrocopy | SISYQINANCSRLQNRVSGDFKR<GAQFLTEFAPQGKISCSGGGERTVSSCVRGRLMEVDEIILHEPSVL |
Parental | QE-KPS-TEGYIAVVLPKFEESKSITEGLLTQKQYEEVVLKRADATTATS |
.E.KPS..EGY.AVVLPKFEESKS.TEG.LTQK..EEVV.K...AT.ATS | |
Retrocopy | *E<KPS<AEGYTAVVLPKFEESKSETEGFLTQKPCEEVV-KCINATAATS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 7 .78 RPM |
SRP017611_kidney | 0 .00 RPM | 3 .65 RPM |
SRP017611_liver | 0 .00 RPM | 1 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004996 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000028510 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000005927 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000008618 | 1 retrocopy | |
Homo sapiens | ENSG00000119328 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000013637 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000002074 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000012563 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000001882 | 1 retrocopy |
retro_ocun_1527 ,
|
Otolemur garnettii | ENSOGAG00000024317 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019483 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009305 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000027231 | 1 retrocopy |