RetrogeneDB ID: | retro_ocun_1923 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | X:41771711..41772138(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MAGOH | ||
| Ensembl ID: | ENSOCUG00000001880 | ||
| Aliases: | None | ||
| Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
| Percent Identity: | 68.97 % |
| Parental protein coverage: | 97.3 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | AMESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEI |
| .M..DFYL.Y.VGHKGKF.H.FLEFEF..DGK.RY.N.S.YKN..MIRK.A.V.KSVME.LK.IID..EI | |
| Retrocopy | SMGNDFYLCYHVGHKGKFAHGFLEFEFWTDGKFRYVN-SKYKNHLMIRK*A*VPKSVMEALKSIID-REI |
| Parental | TKEDDALWPPP-DRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIG |
| TKE.DALW.P..DRVG....EIVI.D..ISF.TSK...LI.VNQSK.P.GLRVFYY..QD.KCLVFSLIG | |
| Retrocopy | TKENDALWLPS>DRVGPLKFEIVIRD*FISFDTSKTDFLISVNQSKSPKGLRVFYYWIQDMKCLVFSLIG |
| Parental | LHFKI |
| L.FK. | |
| Retrocopy | LIFKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 12 .09 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
| Homo sapiens | ENSG00000162385 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001335 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |