RetrogeneDB ID: | retro_ocun_1923 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | X:41771711..41772138(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MAGOH | ||
Ensembl ID: | ENSOCUG00000001880 | ||
Aliases: | None | ||
Description: | mago-nashi homolog, proliferation-associated (Drosophila) [Source:HGNC Symbol;Acc:6815] |
Percent Identity: | 68.97 % |
Parental protein coverage: | 97.3 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | AMESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEI |
.M..DFYL.Y.VGHKGKF.H.FLEFEF..DGK.RY.N.S.YKN..MIRK.A.V.KSVME.LK.IID..EI | |
Retrocopy | SMGNDFYLCYHVGHKGKFAHGFLEFEFWTDGKFRYVN-SKYKNHLMIRK*A*VPKSVMEALKSIID-REI |
Parental | TKEDDALWPPP-DRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIG |
TKE.DALW.P..DRVG....EIVI.D..ISF.TSK...LI.VNQSK.P.GLRVFYY..QD.KCLVFSLIG | |
Retrocopy | TKENDALWLPS>DRVGPLKFEIVIRD*FISFDTSKTDFLISVNQSKSPKGLRVFYYWIQDMKCLVFSLIG |
Parental | LHFKI |
L.FK. | |
Retrocopy | LIFKL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 12 .09 RPM |
SRP017611_kidney | 0 .00 RPM | 21 .89 RPM |
SRP017611_liver | 0 .00 RPM | 7 .78 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000004538 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000011511 | 1 retrocopy | |
Homo sapiens | ENSG00000162385 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007594 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000006406 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000002444 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017987 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000001880 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000013328 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000009020 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001335 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000000753 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012778 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000001253 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000011611 | 17 retrocopies |