RetrogeneDB ID: | retro_ocun_406 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 1:153052735..153052936(-) | ||
Located in intron of: | ENSOCUG00000015212 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC169 | ||
Ensembl ID: | ENSOCUG00000026427 | ||
Aliases: | None | ||
Description: | coiled-coil domain containing 169 [Source:HGNC Symbol;Acc:34361] |
Percent Identity: | 64.79 % |
Parental protein coverage: | 59.13 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | MGEGRGENFD-GVSTDRLKLELLEEIHMKD-IVQLSMLEIRHKIAELEAKLKGD-DEGGEWKIRYETQLE |
.GEGRGENF...VSTD.L.LELLEEI.....I.QLSML..R.KIAE.EA...GD..E.GEWK...ETQLE | |
Retrocopy | VGEGRGENFT<NVSTDCLTLELLEEIQWRG<IMQLSMLGTRYKIAEPEASFSGD<QESGEWKAPQETQLE |
Parental | L |
L | |
Retrocopy | L |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004615 | 1 retrocopy | |
Equus caballus | ENSECAG00000011446 | 1 retrocopy | |
Felis catus | ENSFCAG00000008786 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000026427 | 1 retrocopy |
retro_ocun_406 ,
|
Sus scrofa | ENSSSCG00000026564 | 1 retrocopy |