RetrogeneDB ID: | retro_rnor_1037 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 14:17389908..17390096(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lamtor2 | ||
| Ensembl ID: | ENSRNOG00000019908 | ||
| Aliases: | Lamtor2, Mapbpip, RGD1562501, Robld3 | ||
| Description: | mitogen-activated protein-binding protein-interacting protein [Source:RefSeq peptide;Acc:NP_001099911] |
| Percent Identity: | 81.82 % |
| Parental protein coverage: | 51.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | QAFNEDSLKFILMDCMEGRVAITRVAN-LL-LCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS |
| QAFNEDSLKFILMDC.E.RVAITRVAN.LL....Y.KETVGFGML.AK..ALVQYLEEPLT.VAAS | |
| Retrocopy | QAFNEDSLKFILMDCTEDRVAITRVANFLL<MYVYPKETVGFGMLQAK--ALVQYLEEPLTRVAAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 24 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 27 .08 RPM |
| SRP017611_liver | 0 .07 RPM | 20 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000009193 | 1 retrocopy | |
| Felis catus | ENSFCAG00000028596 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000023871 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028062 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016953 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010328 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019908 | 3 retrocopies |
retro_rnor_1037 , retro_rnor_2493, retro_rnor_847,
|
| Tursiops truncatus | ENSTTRG00000013344 | 1 retrocopy |