RetrogeneDB ID: | retro_rnor_1862 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:2592318..2592566(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Lyrm4 | ||
| Ensembl ID: | ENSRNOG00000047970 | ||
| Aliases: | None | ||
| Description: | LYR motif containing 4 [Source:MGI Symbol;Acc:MGI:2683538] |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 91.21 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | VLDLYRAMMRESKHFSAYNYRMYAVRRIRDAFRENKNVKDPVEIQAL-VNKAKRDLEIIRRQVLIGQLYS |
| VLDLYR.M..ESK.FSAYNY.MYAVRRI.DAFRENKNVKDPVEIQA..VNKAKRDLEIIRRQ..IGQ.YS | |
| Retrocopy | VLDLYRVMI*ESKGFSAYNYKMYAVRRIGDAFRENKNVKDPVEIQAR<VNKAKRDLEIIRRQFHIGQAYS |
| Parental | TDKLIIENQENPRT |
| TDKLIIENQE.PRT | |
| Retrocopy | TDKLIIENQEKPRT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .24 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .84 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000031432 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000021370 | 1 retrocopy | |
| Homo sapiens | ENSG00000214113 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005958 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000028065 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000532 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000046573 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011472 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047970 | 2 retrocopies |
retro_rnor_1862 , retro_rnor_2052,
|
| Tursiops truncatus | ENSTTRG00000007073 | 1 retrocopy |