RetrogeneDB ID: | retro_rnor_2184 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 5:158105069..158105410(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cox20 | ||
Ensembl ID: | ENSRNOG00000004553 | ||
Aliases: | None | ||
Description: | COX20 Cox2 chaperone homolog [Source:RefSeq peptide;Acc:NP_001099446] |
Percent Identity: | 70.09 % |
Parental protein coverage: | 95.73 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | MAAASE-PHEPEKKPFKLLGILDVENTP-CARESILYGSLGSIVT--GLGHFLVTSRIRRSCDVGVGGFI |
MAAA.E.P..PEKKP.KLLG.LD..N...CAR.SI.YGSLGS.VT..GLG.FL.T...RR.CDV..GGF. | |
Retrocopy | MAAAPE>PCKPEKKPCKLLGALDAGNIY<CARDSIPYGSLGSLVTVTGLGWFLLTISMRRTCDVEEGGFL |
Parental | LVTLGCWFHCRYNFAKQRIQERIAREGI-KNKILYESTHLDPERKTK |
.VTLGC.FHCRY.FAKQR.QERIAREG..K...L.ESTHLDPERKTK | |
Retrocopy | MVTLGCRFHCRYHFAKQRTQERIAREGT<KTRFL*ESTHLDPERKTK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 31 .56 RPM |
SRP017611_kidney | 0 .00 RPM | 36 .08 RPM |
SRP017611_liver | 0 .00 RPM | 24 .81 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001381 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000012147 | 1 retrocopy | |
Homo sapiens | ENSG00000203667 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000026132 | 7 retrocopies | |
Monodelphis domestica | ENSMODG00000024669 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026500 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004027 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000004534 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000000053 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000002577 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004553 | 2 retrocopies |
retro_rnor_1033, retro_rnor_2184 ,
|
Sorex araneus | ENSSARG00000004625 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000015272 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000005644 | 1 retrocopy |