RetrogeneDB ID: | retro_sara_322 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | scaffold_162523:1802..1999(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ISCU | ||
Ensembl ID: | ENSSARG00000012942 | ||
Aliases: | None | ||
Description: | iron-sulfur cluster scaffold homolog (E. coli) [Source:HGNC Symbol;Acc:29882] |
Percent Identity: | 52.94 % |
Parental protein coverage: | 73.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | SAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAA-LADYKLKQEPKKGE |
S..A.S.L......GK..EEALTI..TDI.KEL.L...KLHCS.L..DA.K...L.DYK..QE...GE | |
Retrocopy | STLA*SLLVIRGMEGKREEEALTILSTDIIKELYLLSKKLHCSELGADAMKGT<LIDYK-NQESRSGE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000011773 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015374 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000007942 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000002828 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012942 | 1 retrocopy |
retro_sara_322 ,
|
Xenopus tropicalis | ENSXETG00000027428 | 1 retrocopy |