RetrogeneDB ID: | retro_sara_526 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | scaffold_230730:4241..4559(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CSRP2 | ||
Ensembl ID: | ENSSARG00000002290 | ||
Aliases: | None | ||
Description: | cysteine and glycine-rich protein 2 [Source:HGNC Symbol;Acc:2470] |
Percent Identity: | 81.48 % |
Parental protein coverage: | 54.92 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | PVWGGGNKCG-ACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG |
PV.GGGNK.G.ACGRTVYHAEEVQ..GRSFH.CC.LCMVCR..LDST.VAIH.EEIYCKS.YGKKYGPKG | |
Retrocopy | PVLGGGNK*G<ACGRTVYHAEEVQGNGRSFHHCCILCMVCREILDSTAVAIHGEEIYCKSYYGKKYGPKG |
Parental | YGYGQGAGTLNMDRGERLGIKPE-SVQPHRPTTNPNTS |
.G.GQG.GTLNMD.GERL.IKPE...QPHRPTTNPNTS | |
Retrocopy | NGHGQGSGTLNMDHGERLDIKPE>CLQPHRPTTNPNTS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000019153 | 6 retrocopies | |
Equus caballus | ENSECAG00000015606 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019648 | 1 retrocopy | |
Homo sapiens | ENSG00000175183 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000026601 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000002384 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000018257 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000017469 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004885 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008330 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000013999 | 6 retrocopies | |
Ochotona princeps | ENSOPRG00000011987 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004790 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000003772 | 1 retrocopy | |
Sorex araneus | ENSSARG00000002290 | 1 retrocopy |
retro_sara_526 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000010876 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000009767 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000014596 | 1 retrocopy | |
Drosophila melanogaster | FBgn0259209 | 1 retrocopy |