RetrogeneDB ID: | retro_ecab_412 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 17:31700494..31700827(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CSRP2 | ||
Ensembl ID: | ENSECAG00000015606 | ||
Aliases: | None | ||
Description: | cysteine and glycine-rich protein 2 [Source:HGNC Symbol;Acc:2470] |
Percent Identity: | 83.78 % |
Parental protein coverage: | 57.51 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | DRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKS |
D.GERLG.KPES.QP..PTTNPNTSKFAQKYGGAEKCSR.GDSVYAAEKIIGAGKP.HKNCF..AK...S | |
Retrocopy | DCGERLGLKPESGQPRKPTTNPNTSKFAQKYGGAEKCSRFGDSVYAAEKIIGAGKP*HKNCF*RAKRRMS |
Parental | LESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
.ESTTLTEKEGEIY.KGCYAK.FGP.GFGYGQGAGA.VH.Q | |
Retrocopy | PESTTLTEKEGEIYWKGCYAKKFGPMGFGYGQGAGAIVHVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 1 .42 RPM |
SRP021940_cerebellum | 0 .00 RPM | 19 .58 RPM |
SRP021940_embryo | 0 .00 RPM | 67 .74 RPM |
SRP021940_placental_villous | 0 .00 RPM | 42 .87 RPM |
SRP021940_synovial_membrane | 0 .00 RPM | 18 .12 RPM |
SRP021940_testis | 0 .00 RPM | 6 .27 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000019153 | 6 retrocopies | |
Equus caballus | ENSECAG00000015606 | 1 retrocopy |
retro_ecab_412 ,
|
Echinops telfairi | ENSETEG00000019648 | 1 retrocopy | |
Homo sapiens | ENSG00000175183 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000026601 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000002384 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000018257 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000017469 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000004885 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008330 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000013999 | 6 retrocopies | |
Ochotona princeps | ENSOPRG00000011987 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004790 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000003772 | 1 retrocopy | |
Sorex araneus | ENSSARG00000002290 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010876 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000009767 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000014596 | 1 retrocopy | |
Drosophila melanogaster | FBgn0259209 | 1 retrocopy |