RetrogeneDB ID: | retro_shar_382 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL841551.1:845049..845379(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GINS2 | ||
| Ensembl ID: | ENSSHAG00000015249 | ||
| Aliases: | None | ||
| Description: | GINS complex subunit 2 (Psf2 homolog) [Source:HGNC Symbol;Acc:24575] |
| Percent Identity: | 60.0 % |
| Parental protein coverage: | 78.99 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | LEKLEEIRDQERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLIKDMWDTRIAKLRVSADSFVK |
| .EKLE.I.DQERKEE.F..MPS.YYMEL.KLL..HA.D.IPKADEIRTLIKDMW....AK..V..DSFV. | |
| Retrocopy | VEKLEVI*DQERKEELFIAMPSLYYMELIKLLSYHALDSIPKADEIRTLIKDMWNIQVAKF*VYVDSFVR |
| Parental | QQEAHAKLDNLTLMEIN-TTGAFLTEALNHMYKLRTNLHP |
| ...A...LDN.TL.......G.F.TE.L.H.Y.L..N.HP | |
| Retrocopy | **KACNNLDNFTLTNLHYLMGEFPTEDLKHKYRLCINFHP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017303 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008760 | 4 retrocopies | |
| Homo sapiens | ENSG00000131153 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000028131 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009069 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000014703 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000016691 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020594 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007616 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008430 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000004944 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000015249 | 1 retrocopy |
retro_shar_382 ,
|
| Sus scrofa | ENSSSCG00000002663 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006220 | 1 retrocopy |