RetrogeneDB ID: | retro_sscr_177 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:136455337..136455652(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPC3 | ||
| Ensembl ID: | ENSSSCG00000009821 | ||
| Aliases: | None | ||
| Description: | Sus scrofa actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mRNA. [Source:RefSeq mRNA;Acc:NM_001185135] |
| Percent Identity: | 82.86 % |
| Parental protein coverage: | 58.43 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | YITLYISECLKK-LQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQ |
| YI.LYIS.C....L.KCNSKS.GEK..YTLG.TNFPIPGE.GFPLN.IYAKPANKQEDE.MRA.LQQLRQ | |
| Retrocopy | YI*LYISDCXXXXLHKCNSKSKGEK*LYTLGTTNFPIPGELGFPLNEIYAKPANKQEDELMRA*LQQLRQ |
| Parental | ETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSL |
| ET.LRLCEKVFDPQN.KPSKWWTCF.KRQFMNKSL | |
| Retrocopy | ETRLRLCEKVFDPQNEKPSKWWTCFMKRQFMNKSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 44 .73 RPM |
| SRP014902_testis | 0 .00 RPM | 32 .11 RPM |
| SRP018288_heart | 0 .05 RPM | 40 .76 RPM |
| SRP018288_kidney | 0 .00 RPM | 106 .48 RPM |
| SRP018288_liver | 0 .00 RPM | 52 .13 RPM |
| SRP018288_lung | 0 .00 RPM | 125 .96 RPM |
| SRP018856_adipose | 0 .00 RPM | 49 .98 RPM |
| SRP035408_brain | 0 .00 RPM | 259 .01 RPM |
| SRP035408_liver | 0 .00 RPM | 117 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008456 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009360 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006992 | 2 retrocopies | |
| Felis catus | ENSFCAG00000004132 | 2 retrocopies | |
| Homo sapiens | ENSG00000111229 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000005485 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006492 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000011628 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002151 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011908 | 1 retrocopy | |
| Oreochromis niloticus | ENSONIG00000003785 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014805 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000009821 | 1 retrocopy |
retro_sscr_177 ,
|