RetrogeneDB ID: | retro_sscr_744 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 3:120248184..120248446(-) | ||
Located in intron of: | ENSSSCG00000008576 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCBD1 | ||
Ensembl ID: | ENSSSCG00000010275 | ||
Aliases: | None | ||
Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:HGNC Symbol;Acc:8646] |
Percent Identity: | 79.12 % |
Parental protein coverage: | 85.58 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MAGKAHRLSAEERDQLLPNLRAVGWNELEG-RDAIFKQFHFKDFNRAFGFMTRVALQAEKLDH-HPEWFN |
MAGKAHRLSAEERDQL.PN.RAVGWNELEG..DAIFKQFHFKDFN.AFGF.TR.ALQAE.L.H.H.EWFN | |
Retrocopy | MAGKAHRLSAEERDQLQPNPRAVGWNELEG<LDAIFKQFHFKDFNGAFGFTTRGALQAETLGH<HSEWFN |
Parental | VYNKVHITLSTHECAGLSERD |
...KVH.TLS..EC.GLSE.D | |
Retrocopy | LC-KVHHTLSSLECVGLSEWD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 18 .45 RPM |
SRP014902_testis | 0 .00 RPM | 54 .88 RPM |
SRP018288_heart | 0 .00 RPM | 21 .79 RPM |
SRP018288_kidney | 0 .00 RPM | 81 .76 RPM |
SRP018288_liver | 0 .00 RPM | 308 .15 RPM |
SRP018288_lung | 0 .00 RPM | 34 .32 RPM |
SRP018856_adipose | 0 .00 RPM | 97 .91 RPM |
SRP035408_brain | 0 .00 RPM | 19 .18 RPM |
SRP035408_liver | 0 .00 RPM | 183 .18 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011866 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012703 | 1 retrocopy | |
Felis catus | ENSFCAG00000001235 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000001397 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016074 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000007201 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000010275 | 1 retrocopy |
retro_sscr_744 ,
|
Takifugu rubripes | ENSTRUG00000017869 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005775 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000004496 | 1 retrocopy |