RetrogeneDB ID: | retro_tbel_885 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_3232:119769..119961(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DYNLT3 | ||
| Ensembl ID: | ENSTBEG00000014383 | ||
| Aliases: | None | ||
| Description: | dynein, light chain, Tctex-type 3 [Source:HGNC Symbol;Acc:11694] |
| Percent Identity: | 53.62 % |
| Parental protein coverage: | 63.46 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | NNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTAS-SC-FWDTTSDGTCT-VRWENRTM |
| ...NQWT...V.Q.L..L..LGK..KYIVTC..VQ..A.G.HTA..SC..WD....G..T..RWENRTM | |
| Retrocopy | SEVNQWTTHAVGQTLSQLTALGKPLKYIVTCVIVQNGA-GLHTAA<SC<LWDSSTGGSRT<LRWENRTM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |