RetrogeneDB ID: | retro_tsyr_1104 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
Coordinates: | scaffold_306725:1517..1736(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RNASEK | ||
Ensembl ID: | ENSTSYG00000006902 | ||
Aliases: | None | ||
Description: | ribonuclease, RNase K [Source:HGNC Symbol;Acc:33911] |
Percent Identity: | 76.71 % |
Parental protein coverage: | 74.49 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | CGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPLTEKDFENGPQNIYSVYEQVSYNCFIAASLY |
CGPKLAAC..VLSAWG.I.L.MLGIF.NVHSAVL.EDV.LTE.DFENGPQN....YE..S.NCFIAA.LY | |
Retrocopy | CGPKLAACILVLSAWGAIRLTMLGIFLNVHSAVLVEDVHLTEEDFENGPQNTDNIYEHASHNCFIAAGLY |
Parental | LLL |
LLL | |
Retrocopy | LLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000004064 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000023883 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000006902 | 2 retrocopies |
retro_tsyr_1104 , retro_tsyr_1737,
|