RetrogeneDB ID: | retro_btau_1441 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 5:96152813..96153121(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMCO1 | ||
| Ensembl ID: | ENSBTAG00000010009 | ||
| Aliases: | None | ||
| Description: | Transmembrane and coiled-coil domain-containing protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q3T0N3] |
| Percent Identity: | 66.98 % |
| Parental protein coverage: | 54.79 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKL-PFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMS |
| M..MKS.FAIG.CFTA..G.F.SIFDGR.V....P.T.LS.I.GL....LL..DT.DCS.IFL.ILCTMS | |
| Retrocopy | MA*MKSLFAIGVCFTAQVGIFKSIFDGRMVTWV>PPTLLSFI*GLPQGSLLEADTIDCSTIFLCILCTMS |
| Parental | -IRQNIQKI-LGLAPSRAATKQAGGFLGPPPPSGKF |
| .I.QNIQKI.L.LA.S.AATK..GGFLGP.PPSGKF | |
| Retrocopy | <IGQNIQKI<LSLALSQAATKHTGGFLGPLPPSGKF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 53 .21 RPM |
| ERP005899_muscle | 0 .00 RPM | 49 .73 RPM |
| SRP017611_brain | 0 .00 RPM | 46 .73 RPM |
| SRP017611_kidney | 0 .00 RPM | 36 .57 RPM |
| SRP017611_liver | 0 .00 RPM | 48 .40 RPM |
| SRP030211_testis | 0 .00 RPM | 32 .24 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010009 | 1 retrocopy |
retro_btau_1441 ,
|
| Canis familiaris | ENSCAFG00000013472 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000009382 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000011045 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000001335 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008441 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000016602 | 1 retrocopy |