RetrogeneDB ID: | retro_btau_467 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 12:36881108..36881469(+) | ||
| Located in intron of: | ENSBTAG00000000278 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSBTAG00000013264 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S24 [Source:UniProtKB/Swiss-Prot;Acc:Q56JU9] |
| Percent Identity: | 73.39 % |
| Parental protein coverage: | 94.62 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | RTRKFMTNRLLQRKQMVIDVLHPGKATV-PKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIY |
| .TRKFMTNRLLQ.K.MVI.VL..GKATV.P....R....K...T.PDVIFVFGFR..FGGGKTTGFGM.Y | |
| Retrocopy | QTRKFMTNRLLQWK*MVI*VLYFGKATV>PEQKFRKN*PKC--TRPDVIFVFGFRIYFGGGKTTGFGMVY |
| Parental | DSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKK |
| .SLDY.K.NEPKHRL.RH.L.EKKKTSRKQ.KE.KNRMKKVRG.AKAN.G.GKK | |
| Retrocopy | ESLDYTK-NEPKHRLLRHSLDEKKKTSRKQQKECKNRMKKVRGNAKANAGPGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 437 .33 RPM |
| ERP005899_muscle | 0 .00 RPM | 1212 .35 RPM |
| SRP017611_brain | 0 .00 RPM | 187 .15 RPM |
| SRP017611_kidney | 0 .00 RPM | 336 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 240 .49 RPM |
| SRP030211_testis | 0 .12 RPM | 173 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000013264 | 9 retrocopies |
retro_btau_1137, retro_btau_1311, retro_btau_1562, retro_btau_285, retro_btau_467 , retro_btau_577, retro_btau_586, retro_btau_788, retro_btau_980,
|
| Felis catus | ENSFCAG00000000849 | 3 retrocopies | |
| Homo sapiens | ENSG00000138326 | 3 retrocopies | |
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027878 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024102 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003778 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012472 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011005 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000002666 | 10 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000013000 | 4 retrocopies |