RetrogeneDB ID: | retro_ptro_393 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 1:209726751..209727152(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSPTRG00000002666 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
| Percent Identity: | 75.56 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTT |
| MNDTVTI.TR..MTN.LLQRKQMVID.L..GK.TVPKTEI.EKL.K.YKTT.DVIFVFGFRT.FGGGK.. | |
| Retrocopy | MNDTVTIWTRELMTNQLLQRKQMVIDILNTGKETVPKTEILEKLVKIYKTTLDVIFVFGFRTYFGGGKIA |
| Parental | GFGMIYD-SLDYAKKNEPKHRLARHGL-YEKKK-TSRKQRKERKNRMKKVRGTAKANVGAGKKQK |
| .FG.IYD..LDY.K..EPKHRLARHGL....KK.TSRKQ..E.KNRMKK.RG.AKANVGAGKK.K | |
| Retrocopy | DFGVIYD>FLDYVKNHEPKHRLARHGL>LHEKKKTSRKQ*DECKNRMKKLRGLAKANVGAGKKPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 165 .41 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 121 .81 RPM |
| SRP007412_heart | 0 .00 RPM | 107 .14 RPM |
| SRP007412_kidney | 0 .00 RPM | 169 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 135 .09 RPM |
| SRP007412_testis | 0 .00 RPM | 76 .82 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_526 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000013264 | 9 retrocopies | |
| Felis catus | ENSFCAG00000000849 | 3 retrocopies | |
| Homo sapiens | ENSG00000138326 | 3 retrocopies | |
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027878 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000024102 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003778 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012472 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011005 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000002666 | 10 retrocopies |
retro_ptro_1023, retro_ptro_1114, retro_ptro_1257, retro_ptro_1555, retro_ptro_1885, retro_ptro_2376, retro_ptro_362, retro_ptro_393 , retro_ptro_478, retro_ptro_983,
|
| Ictidomys tridecemlineatus | ENSSTOG00000013000 | 4 retrocopies |