RetrogeneDB ID: | retro_btau_485 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 12:3436364..3436635(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C21H15ORF40 | ||
| Ensembl ID: | ENSBTAG00000016522 | ||
| Aliases: | C21H15orf40, C15orf40 | ||
| Description: | UPF0235 protein C15orf40 homolog [Source:RefSeq peptide;Acc:NP_001068854] |
| Percent Identity: | 86.81 % |
| Parental protein coverage: | 68.18 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SIAIHAKPGSKQNA-VTDVTTEAVSVAIAAPPTEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVK |
| .IAIHAK.GSKQNA.VTDVTTEAVSV.I.APPTEGEANAEL...LSKVLEL.KSDVVLDKGGKS.EKVV. | |
| Retrocopy | TIAIHAKAGSKQNA>VTDVTTEAVSVDITAPPTEGEANAELYLCLSKVLELGKSDVVLDKGGKSPEKVVR |
| Parental | LLASTPPEEILEKLKKQVEKK |
| LLASTPPEEILEKLKKQVE.K | |
| Retrocopy | LLASTPPEEILEKLKKQVENK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 12 .47 RPM |
| ERP005899_muscle | 0 .00 RPM | 8 .97 RPM |
| SRP017611_brain | 0 .00 RPM | 12 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .38 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .78 RPM |
| SRP030211_testis | 0 .00 RPM | 15 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016522 | 2 retrocopies |
retro_btau_1724, retro_btau_485 ,
|
| Canis familiaris | ENSCAFG00000013185 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015877 | 2 retrocopies | |
| Equus caballus | ENSECAG00000022459 | 1 retrocopy | |
| Homo sapiens | ENSG00000169609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023062 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009564 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007515 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015890 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019374 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010930 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005072 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000016446 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006737 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019514 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006314 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017947 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000030131 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014387 | 6 retrocopies |