RetrogeneDB ID: | retro_cjac_1108 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 13:79543390..79543762(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C15orf40 | ||
Ensembl ID: | ENSCJAG00000015877 | ||
Aliases: | None | ||
Description: | chromosome 15 open reading frame 40 [Source:HGNC Symbol;Acc:28443] |
Percent Identity: | 64.34 % |
Parental protein coverage: | 83.33 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LRLYRALGQVGAEPSTWGSARRPLAAEMPKKAGATTKGKSQSKEPERSLPPSGPVAVDPKGCVTIAIHAK |
L.L.R.L.Q..A..ST.GS...PL...MPKK.GA..KGKS....PER.LPP..P.AV.PKGCVTIAIH.K | |
Retrocopy | LGLGRGLRQLKAALSTRGSTQLPLGTQMPKKTGAMNKGKSLITKPERLLPPLDPMAVNPKGCVTIAIHSK |
Parental | PGSK-QNAVTDLTAE-AINVAIAAPPSE-GEANAELCRYLSK-VLELRKSDVVLDKLCY |
PGSK.QN.VTDLTAE...NVAIAAP..E.GEANAE..RY.SK.VLELR...VVLDK... | |
Retrocopy | PGSKQQNTVTDLTAE<VENVAIAAPRTE<GEANAEH*RYFSK<VLELR-DNVVLDKVVH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 3 .13 RPM |
SRP051959_heart | 0 .00 RPM | 4 .81 RPM |
SRP051959_kidney | 0 .00 RPM | 5 .06 RPM |
SRP051959_liver | 0 .00 RPM | 4 .05 RPM |
SRP051959_lung | 0 .00 RPM | 3 .94 RPM |
SRP051959_lymph_node | 0 .00 RPM | 4 .41 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 8 .52 RPM |
SRP051959_spleen | 0 .00 RPM | 3 .93 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1881 |
Gorilla gorilla | retro_ggor_1378 |
Pongo abelii | retro_pabe_1561 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016522 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000013185 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015877 | 2 retrocopies |
retro_cjac_1108 , retro_cjac_4086,
|
Equus caballus | ENSECAG00000022459 | 1 retrocopy | |
Homo sapiens | ENSG00000169609 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023062 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009564 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000007515 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015890 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019374 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010930 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005072 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000016446 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006737 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019514 | 2 retrocopies | |
Sorex araneus | ENSSARG00000006314 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017947 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000030131 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014387 | 6 retrocopies |