RetrogeneDB ID: | retro_cjac_4086 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:69399561..69399939(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000023258 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C15orf40 | ||
| Ensembl ID: | ENSCJAG00000015877 | ||
| Aliases: | None | ||
| Description: | chromosome 15 open reading frame 40 [Source:HGNC Symbol;Acc:28443] |
| Percent Identity: | 96.03 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MPKKAGATTKGKSQSKEPERSLPPSGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAINVAIAAPPSEG |
| MPKKAGATTKGKSQSKEPERSLPPSGPVAVDP.GCVTIAIHAKPGS.QNAVTDLT.EAINVAIAAPPSEG | |
| Retrocopy | MPKKAGATTKGKSQSKEPERSLPPSGPVAVDPIGCVTIAIHAKPGSRQNAVTDLTVEAINVAIAAPPSEG |
| Parental | EANAELCRYLSKVLELRKSDVVLDKGCKSREKVVKLLASTTPEEILEKLKKEAKKT |
| EANAELCRYLSKVLELRKSDVVLDK..KSREKVVKLLASTTPEEILEKLKKEAKKT | |
| Retrocopy | EANAELCRYLSKVLELRKSDVVLDKSGKSREKVVKLLASTTPEEILEKLKKEAKKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 3 .13 RPM |
| SRP051959_heart | 0 .16 RPM | 4 .81 RPM |
| SRP051959_kidney | 0 .31 RPM | 5 .06 RPM |
| SRP051959_liver | 0 .28 RPM | 4 .05 RPM |
| SRP051959_lung | 0 .24 RPM | 3 .94 RPM |
| SRP051959_lymph_node | 0 .32 RPM | 4 .41 RPM |
| SRP051959_skeletal_muscle | 0 .22 RPM | 8 .52 RPM |
| SRP051959_spleen | 0 .44 RPM | 3 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016522 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000013185 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015877 | 2 retrocopies |
retro_cjac_1108, retro_cjac_4086 ,
|
| Equus caballus | ENSECAG00000022459 | 1 retrocopy | |
| Homo sapiens | ENSG00000169609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023062 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000009564 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007515 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015890 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019374 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010930 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005072 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000016446 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006737 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019514 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006314 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017947 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000030131 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014387 | 6 retrocopies |