RetrogeneDB ID: | retro_mmur_1387 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | scaffold_52524:3288..3615(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C15orf40 | ||
Ensembl ID: | ENSMICG00000009564 | ||
Aliases: | None | ||
Description: | chromosome 15 open reading frame 40 [Source:HGNC Symbol;Acc:28443] |
Percent Identity: | 78.9 % |
Parental protein coverage: | 97.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QNKEPERPLPPLAPVAVDPKGCVTIAIHAKPGSKQNAITDLTAEAVSVAIAAPPSEGEANAELCRYLSKV |
Q.KEPERPLPP.APVAVDPKGCVTIA..AKPGS..NA.TDLTAEA.SVA.AAP.SEGEA.A.LC..LS.V | |
Retrocopy | QSKEPERPLPPSAPVAVDPKGCVTIANLAKPGSTRNAVTDLTAEAASVATAAPGSEGEADARLCPHLSTV |
Parental | LELRKSDVVLDKGGKSREKVVKLLA-STTPEEILEKLKK |
.ELRKSDV.LD.GGKSREKVVKLLA...T.EEILEK.KK | |
Retrocopy | SELRKSDVALDNGGKSREKVVKLLALHATSEEILEKSKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016522 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000013185 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015877 | 2 retrocopies | |
Equus caballus | ENSECAG00000022459 | 1 retrocopy | |
Homo sapiens | ENSG00000169609 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000023062 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009564 | 2 retrocopies |
retro_mmur_1387 , retro_mmur_1601,
|
Myotis lucifugus | ENSMLUG00000007515 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015890 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019374 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010930 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000005072 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000016446 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006737 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019514 | 2 retrocopies | |
Sorex araneus | ENSSARG00000006314 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017947 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000030131 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000014387 | 6 retrocopies |