RetrogeneDB ID: | retro_btau_488 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 12:19563298..19563529(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CRIP1 | ||
| Ensembl ID: | ENSBTAG00000047229 | ||
| Aliases: | None | ||
| Description: | Cysteine-rich protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q56K04] |
| Percent Identity: | 74.68 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MPKCPKCSKEVYFAERVTSLGKDWHRPCLKCE-KCGKTLTS-GGHAEHEGKPYCNHPCYAAMFGPKGFGR |
| MP.CPKC..EVYF.E.VTSLGKDWH.PCLKCE..CGKTLT..G.HAEHEGKP..NHPCY..MFGPKGF.. | |
| Retrocopy | MPMCPKCDMEVYFGEWVTSLGKDWHQPCLKCE<ECGKTLTL>GSHAEHEGKPFGNHPCYTTMFGPKGFRH |
| Parental | GGAESHTFK |
| .GA.SH.FK | |
| Retrocopy | SGAKSHSFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 6 .92 RPM |
| ERP005899_muscle | 0 .11 RPM | 210 .31 RPM |
| SRP017611_brain | 0 .05 RPM | 4 .80 RPM |
| SRP017611_kidney | 0 .12 RPM | 12 .15 RPM |
| SRP017611_liver | 0 .23 RPM | 13 .14 RPM |
| SRP030211_testis | 0 .10 RPM | 14 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy |
retro_btau_488 ,
|
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |