RetrogeneDB ID: | retro_ptro_43 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 22:23240016..23240250(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSPTRG00000039103 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000033768 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 93.75 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGP-KGFGRGGAESHTFK |
ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPY.NH.CYAAMFGP.KGFGRGG.ESHTFK | |
Retrocopy | ERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYGNHTCYAAMFGPTKGFGRGGPESHTFK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 3 .88 RPM |
SRP007412_cerebellum | 0 .04 RPM | 2 .08 RPM |
SRP007412_heart | 0 .61 RPM | 29 .50 RPM |
SRP007412_kidney | 0 .24 RPM | 9 .99 RPM |
SRP007412_liver | 0 .10 RPM | 6 .51 RPM |
SRP007412_testis | 0 .00 RPM | 0 .95 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2550 |
Gorilla gorilla | retro_ggor_3 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
Homo sapiens | ENSG00000213145 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001836 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy |
retro_ptro_43 ,
|
Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |