RetrogeneDB ID: | retro_ttru_1367 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_111520:144147..144378(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTTRG00000004063 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 88.31 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGSHAEHEGKPYCNHPCYAAMFGPKGFGRGG |
| MPKCPKCNKEVYFAERVTSLGKDWH.PCLKCEK.GKTLTS..HAEHEGKPYC.HPCYAA.F.PKGF..GG | |
| Retrocopy | MPKCPKCNKEVYFAERVTSLGKDWHHPCLKCEKRGKTLTSRGHAEHEGKPYCTHPCYAAIFSPKGFRHGG |
| Parental | AESHTFK |
| AESHTFK | |
| Retrocopy | AESHTFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000047229 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000019788 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000001365 | 1 retrocopy | |
| Homo sapiens | ENSG00000213145 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027381 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000001631 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007158 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006209 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000033768 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014240 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000027990 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000807 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004063 | 1 retrocopy |
retro_ttru_1367 ,
|
| Tursiops truncatus | ENSTTRG00000014596 | 1 retrocopy |