RetrogeneDB ID: | retro_btau_496 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 12:36491416..36491611(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000025383 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFC1 | ||
| Ensembl ID: | ENSBTAG00000039582 | ||
| Aliases: | NDUFC1, CI-KFYI | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q02376] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 85.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KLLAPARFPSVSSSRSKFYIQEPPHGSPNWLKVGLTLGTSVFLWIYLIKQHNEDVLEYKRRNGLE |
| KLLAPARFPSVSSSRSKFYIQEPPHGSPNWLKVGLTLGTSVFLWIYLIKQHNEDVLEYKRRNGLE | |
| Retrocopy | KLLAPARFPSVSSSRSKFYIQEPPHGSPNWLKVGLTLGTSVFLWIYLIKQHNEDVLEYKRRNGLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .65 RPM | 11 .68 RPM |
| ERP005899_muscle | 0 .00 RPM | 17 .74 RPM |
| SRP017611_brain | 0 .05 RPM | 7 .81 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .86 RPM |
| SRP017611_liver | 0 .08 RPM | 8 .83 RPM |
| SRP030211_testis | 0 .23 RPM | 16 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011040 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000039582 | 2 retrocopies |
retro_btau_1578, retro_btau_496 ,
|
| Dasypus novemcinctus | ENSDNOG00000015639 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004800 | 11 retrocopies | |
| Felis catus | ENSFCAG00000008548 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000010459 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000006836 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009082 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023590 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001107 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007703 | 1 retrocopy |