RetrogeneDB ID: | retro_btau_606 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 15:64127392..64127767(-) | ||
| Located in intron of: | ENSBTAG00000032151 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SF3B14 | ||
| Ensembl ID: | ENSBTAG00000003407 | ||
| Aliases: | None | ||
| Description: | pre-mRNA branch site protein p14 [Source:RefSeq peptide;Acc:NP_001039482] |
| Percent Identity: | 98.4 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA |
| MAMQAAKRANIRLPPEVN.ILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYV.YEDIFDA | |
| Retrocopy | MAMQAAKRANIRLPPEVNQILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVIYEDIFDA |
| Parental | KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
| KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK | |
| Retrocopy | KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 1 .23 RPM | 34 .10 RPM |
| ERP005899_muscle | 0 .05 RPM | 44 .18 RPM |
| SRP017611_brain | 0 .14 RPM | 14 .02 RPM |
| SRP017611_kidney | 0 .12 RPM | 27 .56 RPM |
| SRP017611_liver | 0 .08 RPM | 22 .27 RPM |
| SRP030211_testis | 0 .14 RPM | 29 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000003407 | 1 retrocopy |
retro_btau_606 ,
|
| Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
| Homo sapiens | ENSG00000115128 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000011902 | 1 retrocopy |