RetrogeneDB ID: | retro_mmul_1262 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:46032093..46032354(-) | ||
| Located in intron of: | ENSMMUG00000016566 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.942 | ||
| Ensembl ID: | ENSMMUG00000001282 | ||
| Aliases: | None | ||
| Description: | pre-mRNA branch site protein p14 [Source:RefSeq peptide;Acc:NP_001247813] |
| Percent Identity: | 80.68 % |
| Parental protein coverage: | 70.4 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | IFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKE |
| IFGKYGPI.QIRVGNTPETRGTAYVVYE.IF.A.NACDHL..FN.C.R.L.VLYYNANRA.QKMDT.K.E | |
| Retrocopy | IFGKYGPIHQIRVGNTPETRGTAYVVYEYIFVAENACDHLPRFNFCDR*LAVLYYNANRAVQKMDT-KEE |
| Parental | EQLKLLKEKYGINTDPPK |
| EQLKLL.EKYGI..D.PK | |
| Retrocopy | EQLKLLMEKYGIKIDAPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .70 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .04 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 15 .63 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .54 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .77 RPM |
| SRP007412_liver | 0 .08 RPM | 14 .69 RPM |
| SRP007412_testis | 0 .08 RPM | 14 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000003407 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
| Homo sapiens | ENSG00000115128 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy |
retro_mmul_1262 ,
|
| Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000011902 | 1 retrocopy |