RetrogeneDB ID: | retro_ptro_1187 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 17:59242963..59243225(+) | ||
Located in intron of: | ENSPTRG00000009486 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000011709 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.52 % |
Parental protein coverage: | 70.4 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | IFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKE |
IFGKYGPI.QIRV.NTPETRGTAYVVYEDIF.AKNACDHLSGFN.C.R.LVVLYYNANRAFQKMDTKK.E | |
Retrocopy | IFGKYGPIHQIRVENTPETRGTAYVVYEDIFVAKNACDHLSGFNFCDR*LVVLYYNANRAFQKMDTKK-E |
Parental | EQLKLLKEKYG-INTDPPK |
EQLKLL.EKYG....DPPK | |
Retrocopy | EQLKLLTEKYG>VKIDPPK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 12 .23 RPM |
SRP007412_cerebellum | 0 .04 RPM | 12 .51 RPM |
SRP007412_heart | 0 .03 RPM | 22 .12 RPM |
SRP007412_kidney | 0 .08 RPM | 26 .99 RPM |
SRP007412_liver | 0 .03 RPM | 21 .96 RPM |
SRP007412_testis | 0 .00 RPM | 18 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1773 |
Pongo abelii | retro_pabe_1461 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002786 | 1 retrocopy | |
Bos taurus | ENSBTAG00000003407 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000000689 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000007716 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007148 | 1 retrocopy | |
Equus caballus | ENSECAG00000015618 | 1 retrocopy | |
Felis catus | ENSFCAG00000031365 | 1 retrocopy | |
Homo sapiens | ENSG00000115128 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001282 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013957 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000000815 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000004468 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000012603 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000011709 | 1 retrocopy |
retro_ptro_1187 ,
|
Sorex araneus | ENSSARG00000011902 | 1 retrocopy |