RetrogeneDB ID: | retro_cfam_479 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 12:6356496..6356757(+) | ||
| Located in intron of: | ENSCAFG00000001458 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM96B | ||
| Ensembl ID: | ENSCAFG00000020394 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 96, member B [Source:HGNC Symbol;Acc:24261] |
| Percent Identity: | 53.93 % |
| Parental protein coverage: | 55.28 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GLLENANPLIYERSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPE |
| G.LE..N.L..E.SGE.......ED.QVP.S......FDLI.SI..PE.P..LE.LNVV.QV..QVSDPE | |
| Retrocopy | GELETSNLLVCEHSGEYLGIMNKEDKQVPVS-SVPGVFDLICSICVPELPQILEKLNVVQQVWLQVSDPE |
| Parental | STVAVAFTPTIPHCSMATL |
| ..VA.AF.PT.PH.SM... | |
| Retrocopy | K-VAMAFIPTLPHYSMLSI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .08 RPM | 42 .33 RPM |
| SRP017611_brain | 0 .00 RPM | 16 .99 RPM |
| SRP017611_kidney | 0 .07 RPM | 53 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017164 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000013931 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017035 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000020394 | 2 retrocopies |
retro_cfam_479 , retro_cfam_802,
|
| Felis catus | ENSFCAG00000029216 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005303 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031879 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004698 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000005006 | 2 retrocopies |