RetrogeneDB ID: | retro_cfam_612 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 14:57931714..57932064(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUDT5 | ||
| Ensembl ID: | ENSCAFG00000004794 | ||
| Aliases: | None | ||
| Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 5 [Source:HGNC Symbol;Acc:8052] |
| Percent Identity: | 58.54 % |
| Parental protein coverage: | 54.34 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | AVIPVLQRTLHYECIVLVKQFRPPMGGYCLEFPAGLI-DDNESPEAAALRELEEETGYKGDVAECSPAVC |
| AV...LQRTLH.E...L.KQF..PMG...L..P..LI.DD...PEAA.L.E.E.ETG..GD..E.SPA.C | |
| Retrocopy | AVVSALQRTLHDEYAFLGKQF*LPMGAKGLKLPIDLI>DDG-NPEAAILLEPEKETGFEGDI-EYSPAEC |
| Parental | MDPGLTNCTTHIVTVTINGDDAEN-VRP-KPKPGDGEFVEVIS-LPKNDLLKR |
| MD.GL..C.TH......N.DDA.N..RP..PK.GDG.FVEV.S.LPKNDLLKR | |
| Retrocopy | MDAGLSGC-THAL*Q*LNEDDAKN<LRP<QPKAGDGQFVEVTSLLPKNDLLKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 11 .21 RPM |
| SRP017611_brain | 0 .00 RPM | 13 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 15 .85 RPM |
| SRP017611_liver | 0 .00 RPM | 11 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019509 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004794 | 2 retrocopies |
retro_cfam_435, retro_cfam_612 ,
|
| Equus caballus | ENSECAG00000023658 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006403 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025093 | 1 retrocopy | |
| Homo sapiens | ENSG00000165609 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006325 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012052 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010453 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000017141 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012298 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009308 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005816 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002091 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002294 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017741 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011113 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007394 | 2 retrocopies |