RetrogeneDB ID: | retro_ptro_2427 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 6:36546600..36546966(-) | ||
Located in intron of: | ENSPTRG00000018097 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUDT5 | ||
Ensembl ID: | ENSPTRG00000002294 | ||
Aliases: | None | ||
Description: | nudix (nucleoside diphosphate linked moiety X)-type motif 5 [Source:HGNC Symbol;Acc:8052] |
Percent Identity: | 86.89 % |
Parental protein coverage: | 55.71 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LIDDGETPEAAALRELEEETGYKGDVAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGILEF |
LI.DGETP.AAAL.ELEEETGYKGD.AECSP.V.MDPGLSNCT.HIVTV.INGDDAEN.RPKPKPG..EF | |
Retrocopy | LIEDGETPGAAALWELEEETGYKGDAAECSPVVYMDPGLSNCTTHIVTVIINGDDAENVRPKPKPGDGEF |
Parental | VEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
VEVISLPKNDLLQ.LDALVAE.HLTVDARVYS.ALALKHAN.KPFEVP.LKF | |
Retrocopy | VEVISLPKNDLLQGLDALVAEKHLTVDARVYSHALALKHANVKPFEVPVLKF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .13 RPM | 7 .35 RPM |
SRP007412_cerebellum | 0 .50 RPM | 6 .92 RPM |
SRP007412_heart | 0 .12 RPM | 2 .62 RPM |
SRP007412_kidney | 0 .65 RPM | 21 .31 RPM |
SRP007412_liver | 0 .59 RPM | 21 .38 RPM |
SRP007412_testis | 0 .11 RPM | 4 .64 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3580 |
Gorilla gorilla | retro_ggor_2415 |
Pongo abelii | retro_pabe_2949 |
Macaca mulatta | retro_mmul_1828 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000019509 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000004794 | 2 retrocopies | |
Equus caballus | ENSECAG00000023658 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006403 | 1 retrocopy | |
Felis catus | ENSFCAG00000025093 | 1 retrocopy | |
Homo sapiens | ENSG00000165609 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006325 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012052 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000010453 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000017141 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012298 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000009308 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000005816 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002091 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000002294 | 1 retrocopy |
retro_ptro_2427 ,
|
Rattus norvegicus | ENSRNOG00000017741 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011113 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000007394 | 2 retrocopies |