RetrogeneDB ID: | retro_chof_190 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | GeneScaffold_426:210743..210959(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SUMO1 | ||
Ensembl ID: | ENSCHOG00000009739 | ||
Aliases: | None | ||
Description: | small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502] |
Percent Identity: | 90.54 % |
Parental protein coverage: | 51.06 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | DSSEIHFKVK-MTTHLK-KLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG |
DSSEIHFKVK.MT.HLK.KLKE.YCQR.GVPMNSLRFLFEGQRIADNHTPKELGMEEED.IEVYQEQT.G | |
Retrocopy | DSSEIHFKVK<MTKHLK>KLKELYCQRWGVPMNSLRFLFEGQRIADNHTPKELGMEEEDAIEVYQEQTRG |
Parental | HSTV |
HSTV | |
Retrocopy | HSTV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013225 | 5 retrocopies | |
Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000009739 | 2 retrocopies |
retro_chof_190 , retro_chof_2068,
|
Choloepus hoffmanni | ENSCHOG00000010239 | 1 retrocopy | |
Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
Loxodonta africana | ENSLAFG00000022855 | 5 retrocopies | |
Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005240 | 7 retrocopies | |
Mustela putorius furo | ENSMPUG00000000335 | 2 retrocopies | |
Mus musculus | ENSMUSG00000026021 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006997 | 4 retrocopies | |
Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy |