RetrogeneDB ID: | retro_mmus_1594 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 17:79420494..79420675(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Sumo1 | ||
Ensembl ID: | ENSMUSG00000026021 | ||
Aliases: | Sumo1, GMP1, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1 | ||
Description: | SMT3 suppressor of mif two 3 homolog 1 (yeast) [Source:MGI Symbol;Acc:MGI:1197010] |
Percent Identity: | 56.45 % |
Parental protein coverage: | 60.4 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQG-VPMNSLRFLFEGQRI |
.DLGDK.EGEY..L.V...DS.E..FKVK.T..LK.LKESY.Q.QG..P..SL......QRI | |
Retrocopy | KDLGDK*EGEYPQLRVAA*DSKESSFKVKQTMCLKGLKESYYQ-QG>TPIDSLKLFIDSQRI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 24 .86 RPM |
SRP007412_cerebellum | 0 .00 RPM | 23 .27 RPM |
SRP007412_heart | 0 .00 RPM | 14 .60 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .67 RPM |
SRP007412_liver | 0 .00 RPM | 12 .70 RPM |
SRP007412_testis | 0 .00 RPM | 24 .20 RPM |