RetrogeneDB ID: | retro_cjac_1003 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:98655477..98655772(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000018888 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000004427 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.57 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAQGQRKFQAHKPAKSK-TAAAASEKNRGPRKGGRVI-APKKARVVQQQKLKKNLEVGIRKKIEHDVMMK |
| MAQGQ.K.QAHKP.K.....AA.SE...GPRKGGRV..APKKARVVQQQKLKKN.EVGI.KKIEHDV..K | |
| Retrocopy | MAQGQCKLQAHKPSKRQ<AGAA-SERDQGPRKGGRVM<APKKARVVQQQKLKKNREVGIWKKIEHDVVRK |
| Parental | AS-CLPKKLALLKAPAKNR-AAATTSSNKAPS |
| .S..LPKKLA.LKA.AK...AAA.TSSNK..S | |
| Retrocopy | VSNSLPKKLAPLKALAKKKGAAAATSSNKTLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .13 RPM | 5 .59 RPM |
| SRP051959_heart | 0 .00 RPM | 5 .49 RPM |
| SRP051959_kidney | 0 .02 RPM | 7 .28 RPM |
| SRP051959_liver | 0 .02 RPM | 8 .06 RPM |
| SRP051959_lung | 0 .02 RPM | 6 .72 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 7 .05 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 9 .32 RPM |
| SRP051959_spleen | 0 .06 RPM | 6 .87 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002525 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004427 | 3 retrocopies |
retro_cjac_1003 , retro_cjac_2634, retro_cjac_291,
|
| Homo sapiens | ENSG00000104979 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027024 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011876 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013141 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007185 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000014250 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010565 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000006321 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010354 | 1 retrocopy |