RetrogeneDB ID: | retro_ptro_457 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 10:110475098..110475391(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C19orf53 | ||
Ensembl ID: | ENSPTRG00000010565 | ||
Aliases: | None | ||
Description: | chromosome 19 open reading frame 53 [Source:HGNC Symbol;Acc:24991] |
Percent Identity: | 80.2 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAQGQRKFQAHKPAKSKT-AAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKA |
.AQGQRKFQA..P...K..AAAASE.NRG.RK.GRV.APKKA.V.QQQKLKKNLEV.I.KKIEH.VVMKA | |
Retrocopy | LAQGQRKFQA--PKPAKR<AAAASERNRGRRKDGRVTAPKKACVGQQQKLKKNLEVRIWKKIEHAVVMKA |
Parental | SSSLPKKLALLKAPAKKKGAAAATSS-KTPS |
S.SLPKKLALLKAP.KKKGAAAATSS.KTPS | |
Retrocopy | SNSLPKKLALLKAPTKKKGAAAATSSNKTPS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 40 .36 RPM |
SRP007412_cerebellum | 0 .04 RPM | 18 .68 RPM |
SRP007412_heart | 0 .00 RPM | 15 .56 RPM |
SRP007412_kidney | 0 .00 RPM | 40 .43 RPM |
SRP007412_liver | 0 .00 RPM | 39 .90 RPM |
SRP007412_testis | 0 .11 RPM | 9 .91 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_628 |
Gorilla gorilla | retro_ggor_550 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002525 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004427 | 3 retrocopies | |
Homo sapiens | ENSG00000104979 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027024 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000011876 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013141 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007185 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000014250 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000010565 | 1 retrocopy |
retro_ptro_457 ,
|
Pteropus vampyrus | ENSPVAG00000006321 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010354 | 1 retrocopy |