RetrogeneDB ID: | retro_ptro_457 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 10:110475098..110475391(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19orf53 | ||
| Ensembl ID: | ENSPTRG00000010565 | ||
| Aliases: | None | ||
| Description: | chromosome 19 open reading frame 53 [Source:HGNC Symbol;Acc:24991] |
| Percent Identity: | 80.2 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MAQGQRKFQAHKPAKSKT-AAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKA |
| .AQGQRKFQA..P...K..AAAASE.NRG.RK.GRV.APKKA.V.QQQKLKKNLEV.I.KKIEH.VVMKA | |
| Retrocopy | LAQGQRKFQA--PKPAKR<AAAASERNRGRRKDGRVTAPKKACVGQQQKLKKNLEVRIWKKIEHAVVMKA |
| Parental | SSSLPKKLALLKAPAKKKGAAAATSS-KTPS |
| S.SLPKKLALLKAP.KKKGAAAATSS.KTPS | |
| Retrocopy | SNSLPKKLALLKAPTKKKGAAAATSSNKTPS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 40 .36 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 18 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 15 .56 RPM |
| SRP007412_kidney | 0 .00 RPM | 40 .43 RPM |
| SRP007412_liver | 0 .00 RPM | 39 .90 RPM |
| SRP007412_testis | 0 .11 RPM | 9 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_628 |
| Gorilla gorilla | retro_ggor_550 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002525 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004427 | 3 retrocopies | |
| Homo sapiens | ENSG00000104979 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027024 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011876 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013141 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007185 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000014250 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010565 | 1 retrocopy |
retro_ptro_457 ,
|
| Pteropus vampyrus | ENSPVAG00000006321 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010354 | 1 retrocopy |