RetrogeneDB ID: | retro_ggor_550 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 10:124899973..124900228(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000026027 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C19ORF53 | ||
| Ensembl ID: | ENSGGOG00000027024 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.18 % |
| Parental protein coverage: | 84.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKKLALLKAPAK |
| S..AAAASE.NRG.RK.GRV.APKKA.V.QQQKL.KNLEV.I.KKIEH..VMKAS.SLPKKLALLKAP.K | |
| Retrocopy | SEEAAAASERNRGRRKDGRVTAPKKACVGQQQKLNKNLEVRIWKKIEHAMVMKASNSLPKKLALLKAPTK |
| Parental | KKGAAAATSS-KTPS |
| KKGAAAATSS.KTPS | |
| Retrocopy | KKGAAAATSSNKTPS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 44 .69 RPM |
| SRP007412_cerebellum | 0 .08 RPM | 20 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 24 .17 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .67 RPM |
| SRP007412_liver | 0 .00 RPM | 24 .32 RPM |
| SRP007412_testis | 0 .10 RPM | 20 .41 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_628 |
| Pan troglodytes | retro_ptro_457 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002525 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004427 | 3 retrocopies | |
| Homo sapiens | ENSG00000104979 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027024 | 1 retrocopy |
retro_ggor_550 ,
|
| Monodelphis domestica | ENSMODG00000011876 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013141 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007185 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000014250 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010565 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000006321 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010354 | 1 retrocopy |